General Information

  • ID:  hor005447
  • Uniprot ID:  P11953
  • Protein name:  Relaxin B chain
  • Gene name:  NA
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QSFKNAEPGIKLCGREFIRAVIYTCGGSRW
  • Length:  30(1-30)
  • Propeptide:  QSFKNAEPGIKLCGREFIRAVIYTCGGSRWEGSPGMSSKCCTYGCTRKDISILC
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The function of relaxin in an oviparous species is not yet known.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11953-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005447_AF2.pdbhor005447_ESM.pdb

Physical Information

Mass: 390537 Formula: C151H236N44O41S2
Absent amino acids: DHM Common amino acids: G
pI: 9.5 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -24.33 Boman Index: -4922
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 68.33
Instability Index: 4403 Extinction Coefficient cystines: 7115
Absorbance 280nm: 245.34

Literature

  • PubMed ID:  3780747
  • Title:  Isolation, purification, and the sequence of relaxin from spiny dogfish (Squalus acanthias)